Protein Info for Atu2333 in Agrobacterium fabrum C58

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 PF00270: DEAD" amino acids 38 to 208 (171 residues), 173 bits, see alignment E=6.9e-55 PF04851: ResIII" amino acids 58 to 203 (146 residues), 35.8 bits, see alignment E=1.2e-12 PF00271: Helicase_C" amino acids 245 to 353 (109 residues), 114.7 bits, see alignment E=3.8e-37

Best Hits

KEGG orthology group: K11927, ATP-dependent RNA helicase RhlE [EC: 3.6.4.13] (inferred from 100% identity to atu:Atu2333)

Predicted SEED Role

"ATP-dependent RNA helicase RhlE" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CHZ8 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Atu2333 ATP-dependent RNA helicase (Agrobacterium fabrum C58)
MSLFWRPERQYILTSFNELGLSEKIVASVTQLGYTTPTPIQAKAIPLLLEGRDLIGLAQT
GTGKTAAFGLPIIEMLMKQADRPANRTTRTLILAPTRELVNQIGDNLRSFVKKTPLRINQ
VVGGASINKQQLQLEKGTDILVATPGRLLDLIARNAISLSKVTYLVLDEADQMLDLGFIH
DLRKISRMVPPKRQTLLFSATMPKAISELASNFLTDPIKVEVTPPGKAADKVEQYVHFVA
GKNDKTDLLKKSLNENPDGRSIVFLRTKHGAEKLYKHLEHIGFKVASIHGNKSQGQRERA
LKGFKDGEIKVLVATDVAARGIDIPAVTHVFNYDLPEVPDAYVHRIGRTARAGRDGIAIA
FCAPDETRLLHDIEKLMKIDIPVASGERPAGLASPTRPNNNRGGRNNNGGQPRGPREGGR
HNGESRPSRNHAPRDADNDLEVTSDFKRVKQAEGDAGRPAGPRKQRRPARKPGGSGANRH
APAGGNGQEKRASGNGNRGRNR