Protein Info for Atu2318 in Agrobacterium fabrum C58

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01070: FMN_dh
  • amino acids 19 to 381 (363 residues), 468.6 bits, E=1.9e-144
• PF03060: NMO
  • amino acids 263 to 341 (79 residues), 29.3 bits, E=9.1e-11
• PF01645: Glu_synthase
  • amino acids 302 to 343 (42 residues), 26 bits, 7.8e-10

Best Hits

Swiss-Prot: 48% identical to LLDD_PSEMY: L-lactate dehydrogenase (lldD) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K00101, L-lactate dehydrogenase (cytochrome) [EC: 1.1.2.3] (inferred from 100% identity to atu:Atu2318)

MetaCyc: 46% identical to L-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
1.1.5.M6 [EC: 1.1.5.M6]; RXN0-7227 [EC: 1.1.5.M6]

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

• L-lactaldehyde degradation (aerobic) (2/2 steps found)
• methylglyoxal degradation IV (2/3 steps found)
• methylglyoxal degradation V (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)
• superpathway of fucose and rhamnose degradation (7/12 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (2/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3 or 1.1.5.M6

Sequence Analysis Tools

See A9CI08 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Atu2318 L-lactate dehydrogenase (Agrobacterium fabrum C58)
MKALSMGKILTIADLKQQAQRRVPKMFFDYADSGAWTESTYRANEDDFAKIKLRQRVLVD
MTDRSLATEMVGEKVSMPVALSPTGLTGMQHADGEMLAAKAAEEFGVPFTLSTMSICSIE
DVASVTSKPFWFQLYVMKDRDFVNNLIDRAKAAGCSALVLTLDLQILGQRHKDLRNGLSA
PPKFTPKHIWQMATRPQWCMDMARTKRRSFGNIVGHAKNVSDLSSLSTWTAEQFDPRLSW
QDVEWIKQRWGGKLILKGILDEEDARAAIDTGADAIIVSNHGGRQLDGAHSSIAMLPKIV
DAVGDRIEVHMDGGIRSGQDVLKAVALGARGTYIGRPFLYGLGAGGKQGVTTALEIIRKE
LDISMALCGKRLITDVDRSILA