Protein Info for Atu2308 in Agrobacterium fabrum C58

Annotation: d-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 3 to 258 (256 residues), 391.3 bits, see alignment E=8.6e-122 PF00106: adh_short" amino acids 4 to 194 (191 residues), 200.7 bits, see alignment E=4.4e-63 PF08659: KR" amino acids 4 to 162 (159 residues), 44.5 bits, see alignment E=4.3e-15 PF01370: Epimerase" amino acids 5 to 250 (246 residues), 21.3 bits, see alignment E=4.1e-08 PF13561: adh_short_C2" amino acids 11 to 256 (246 residues), 204 bits, see alignment E=6.8e-64 PF23441: SDR" amino acids 114 to 254 (141 residues), 34 bits, see alignment E=5.5e-12

Best Hits

Swiss-Prot: 66% identical to BDHA_RHIME: D-beta-hydroxybutyrate dehydrogenase (bdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 100% identity to atu:Atu2308)

MetaCyc: 34% identical to cyclohexanol dehydrogenase (Aromatoleum aromaticum EbN1)
1.1.1.-

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXD5 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Atu2308 d-beta-hydroxybutyrate dehydrogenase (Agrobacterium fabrum C58)
MHRTVIVTGSTSGIGLGIAQRFAREGANIVLNGFGDDDEIEKLRLLLEAESGGRVLYHPA
DMTKPDEIADLIQSSHEKLGSVDVLINNAGIQHIAPIEEFPTEKWDWIIAINLTSSFHTM
RAAIPLMKKAGKGRIINISSAHGLVASPFKSAYVAAKHGIMGLTKTAALELAQTGVTVNA
ICPGYVLTPLVEKQIPEMAKVRGISEAAVKNDVMLELQATKQFVTVDDVAAAAIFLASDA
ASNITGTHISVDGGWTAQ