Protein Info for Atu2296 in Agrobacterium fabrum C58
Annotation: 2-dehydro-3-deoxygluconokinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00874, 2-dehydro-3-deoxygluconokinase [EC: 2.7.1.45] (inferred from 100% identity to atu:Atu2296)Predicted SEED Role
"2-dehydro-3-deoxygluconate kinase (EC 2.7.1.45)" in subsystem D-Galacturonate and D-Glucuronate Utilization or D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 2.7.1.45)
MetaCyc Pathways
- 4-deoxy-L-threo-hex-4-enopyranuronate degradation (5/5 steps found)
- D-fructuronate degradation (4/4 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
- superpathway of β-D-glucuronosides degradation (5/7 steps found)
- superpathway of microbial D-galacturonate and D-glucuronate degradation (22/31 steps found)
- D-galacturonate degradation I (3/5 steps found)
- 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
- alginate degradation (4/7 steps found)
- superpathway of hexuronide and hexuronate degradation (6/10 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.1.45
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q7CXE6 at UniProt or InterPro
Protein Sequence (295 amino acids)
>Atu2296 2-dehydro-3-deoxygluconokinase (Agrobacterium fabrum C58) MVELSQAGNGLLRKGFAGDTFNAAWYARACLPQDWSVDYFTALGDDPLSEDMLAFIAEAG IGTEKIRRIKGGTPGLYLINLKDGERTFSYWRNAAAARQLAADADHLRKTVESADVVYFS GITLAILASAHDVDTFLAELRRARAAGKLVVFDPNIRPRLWADRDVMLETISNGARAATL VMPSFDDEASHFGDVSVEATIARYRSLGVENIVVKDGAKGATLDFGGSRSHAPAEKAVDV VDTTSAGDSFNGAFLARYVTGSSPEEAATFAARAAATVIGHHGALISPELLPLVG