Protein Info for Atu2290 in Agrobacterium fabrum C58

Annotation: probable acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 PF13302: Acetyltransf_3" amino acids 7 to 141 (135 residues), 57.1 bits, see alignment E=9.9e-19 PF00583: Acetyltransf_1" amino acids 47 to 141 (95 residues), 74.6 bits, see alignment E=2.4e-24 PF13673: Acetyltransf_10" amino acids 54 to 146 (93 residues), 38.6 bits, see alignment E=3e-13 PF13508: Acetyltransf_7" amino acids 60 to 142 (83 residues), 54.5 bits, see alignment E=3.9e-18 PF13420: Acetyltransf_4" amino acids 60 to 160 (101 residues), 34.5 bits, see alignment E=6.2e-12 PF08445: FR47" amino acids 86 to 143 (58 residues), 27.8 bits, see alignment E=6.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2290)

Predicted SEED Role

"Probable acetyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI25 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Atu2290 probable acetyltransferase (Agrobacterium fabrum C58)
MALDDTVTIKPIRAEHVESFHRALDAVSRERKYLSFLEAPPLEAVRAFVLDMIENDHPQF
VAIADGDVIGWCDIRRQDRATRAHCGTLGMGILPAYRNKGLGARLMRRTLDAAHEFGLHR
IELSVHADNARAIALYEKIGFAHEGRARDAVSIDGHYIDSLNMAIIFGN