Protein Info for Atu2286 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details TIGR00645: TIGR00645 family protein" amino acids 5 to 163 (159 residues), 169.6 bits, see alignment E=3.7e-54 PF03350: UPF0114" amino acids 12 to 126 (115 residues), 102 bits, see alignment E=1.3e-33

Best Hits

Swiss-Prot: 51% identical to Y2386_SERP5: UPF0114 protein Spro_2386 (Spro_2386) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2286)

Predicted SEED Role

"Putative inner membrane protein (Fragment)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI29 at UniProt or InterPro

Protein Sequence (173 amino acids)

>Atu2286 hypothetical protein (Agrobacterium fabrum C58)
MKSLELLVERIILSSRWLLVVFYLGLVAALAVYAFSFALKFLKVAKNVFIYDESDMILAM
LGLIDAALVASLIVMVMISGYENFVSRFDEADDEVSFLGKLDSGSLKIKVASSIVAISSI
HLLQIFLNASQYTDSQLMWFTIIHLAFVVSAVMLGFLEKLMAKPKDKSEKQVL