Protein Info for Atu2280 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (proline/glycine betaine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 88 to 99 (12 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 202 to 229 (28 residues), see Phobius details amino acids 239 to 257 (19 residues), see Phobius details amino acids 275 to 300 (26 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details TIGR03416: choline ABC transporter, permease protein" amino acids 69 to 334 (266 residues), 435.4 bits, see alignment E=4.1e-135 PF00528: BPD_transp_1" amino acids 173 to 335 (163 residues), 88.6 bits, see alignment E=2.2e-29

Best Hits

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 100% identity to atu:Atu2280)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXG1 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Atu2280 ABC transporter, membrane spanning protein (proline/glycine betaine) (Agrobacterium fabrum C58)
MDLHRARQRRCRPSLLYWSNSGDNRSLKKLRFFVVCAIPDAKPLCIFAGIALIHERSFLT
VEWLSAPENRLPIGRYAKEAIDWLTGNLAFFFDWLSFIFQSVINALLYVLQAPHPLIIVA
IVTALSAWTRRSAGMPIFTALGLLLIINLGYWKATTETLALVIAASAVCMIIGIPLGILA
ARRKWIYAGMRPALDLMQTIPTFVYLIPALVLFGLGMVPGLIATVIFAIPAPVRLTRLGI
VSTPPALVEAAVAFGATPSQVLRKVELPFAAPQIMAGLTQTIMLSLSMVVISALVGANGL
GVPVVRALNTVNIAMGFEAGLCIVILAIVLDRLFRLPGTEDDL