Protein Info for Atu2276 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (branched chain amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 24 to 362 (339 residues), 206.9 bits, see alignment E=1.1e-64 PF13433: Peripla_BP_5" amino acids 26 to 347 (322 residues), 70.3 bits, see alignment E=2.5e-23 PF01094: ANF_receptor" amino acids 44 to 360 (317 residues), 74.3 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 68% identical to LIVB3_BRUSU: Leu/Ile/Val-binding protein homolog 3 (BR0014) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to atu:Atu2276)

Predicted SEED Role

"High-affinity leucine-specific transport system, periplasmic binding protein LivK (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI34 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Atu2276 ABC transporter, substrate binding protein (branched chain amino acid) (Agrobacterium fabrum C58)
MKLKTLTSVTLAASFAFAPLAHAEIVIGLIAPLTGPVAAYGDQVKNGAQTAVSEINKKGG
ILGEQVVLKLADDGGEPKQGVSAANQLVAEGIHFVVGPVTSGVAIPASDVFAENGVLMVT
PTATAPGLTNRGLSNVFRTCGRDDQQAEVAAKYVLANLKGKKIAIIHDKGAYGKGLADSF
KATLNAGGVTEVLYDALTPGEKDLGALTARLKSDNADIVYFGGYHPEAGLLVRQLKDIGS
KAAVIGGDGLSNSEFWNIGAKAGEGTIFTNASDALKNDDSKAAAEALKAANIPAEAFTLN
AYAAVEVLKAGIEKAGSAKDSEAVAKVLKSGEAFPTAIGKVTYGDNGDLTSQAFSLFKWQ
DGKIVAAE