Protein Info for Atu2274 in Agrobacterium fabrum C58

Annotation: cation efflux system protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 13 to 290 (278 residues), 237.6 bits, see alignment E=8.8e-75 PF01545: Cation_efflux" amino acids 19 to 207 (189 residues), 144.3 bits, see alignment E=4.4e-46 PF16916: ZT_dimer" amino acids 213 to 289 (77 residues), 87.1 bits, see alignment E=6.3e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2274)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI36 at UniProt or InterPro

Protein Sequence (300 amino acids)

>Atu2274 cation efflux system protein (Agrobacterium fabrum C58)
MNNEGNALVRKLAFWGIPLSFGVLGLKLVAWWVTGSVALLSDGLESTVNVVAAFIAYFVI
RYAQKPADDDHQFGHHKAEYISAVVEGVLIVVAALLIVQEAWGALFNPRLPEAPALGLAI
NAMAGVINAVWATILIRVGKKHSSPALAADGHHIMSDVVTSVGVLVGLVLALMTGYAILD
PLLAILVAINILFQGSKVIIHSLGGLMDRAVEPEEDEAIKKAIAENSGGVIGVHDLRTRR
AGSAAFIDFHVVVPASMTVQEAHDICDRLEDAIRDVIPGASLAIHVEPEGEKAHGVKVIV