Protein Info for Atu2268 in Agrobacterium fabrum C58

Annotation: ECF family sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 13 to 164 (152 residues), 66.3 bits, see alignment E=1.3e-22 PF04542: Sigma70_r2" amino acids 16 to 85 (70 residues), 49.6 bits, see alignment E=2.7e-17 PF08281: Sigma70_r4_2" amino acids 109 to 159 (51 residues), 32.6 bits, see alignment E=5e-12

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu2268)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXH2 at UniProt or InterPro

Protein Sequence (169 amino acids)

>Atu2268 ECF family sigma factor (Agrobacterium fabrum C58)
MLRSLDGDEASYRHLLHALRRLLVAYYGRRMADAARADVEDLVQETLLSLHAKRETYDRA
RPFTAWFFSIARYKLIDHYRGRGRRMFSEVELDETLEAESSVDAVTARMDVERLLNELPE
RQRDLIRRVKLEGQSIAEAAEKSGQTELAARVGIHRTLKVLAAKLRGDI