Protein Info for Atu2259 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 25 to 51 (27 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 111 to 134 (24 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 379 to 402 (24 residues), see Phobius details amino acids 407 to 427 (21 residues), see Phobius details PF07690: MFS_1" amino acids 38 to 395 (358 residues), 142 bits, see alignment E=2.3e-45 amino acids 296 to 424 (129 residues), 40.5 bits, see alignment E=1.7e-14 PF00083: Sugar_tr" amino acids 63 to 434 (372 residues), 128.5 bits, see alignment E=3.4e-41

Best Hits

KEGG orthology group: K08369, MFS transporter, putative metabolite:H+ symporter (inferred from 100% identity to atu:Atu2259)

Predicted SEED Role

"Niacin transporter NiaP" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI41 at UniProt or InterPro

Protein Sequence (437 amino acids)

>Atu2259 MFS permease (Agrobacterium fabrum C58)
MTAITMNDALERAGAGAYQRRLMGIFGLVWAADAMQVLAVGFTAASIAATFGLTVPQALQ
TGTAFFFGMLLGAAGFGRLADRYGRRRVLIVTVACDALFGVLSIFSPDFTILLVLRFLTG
AAVGGTLPVDYAMMAEFLPAKNRGRWLVFLEGFWAVGTLIVALAAWGASLAGVADAWRYI
FAVTAFPAVLGLGLRFLVPESPLYLLRTGRSEEAKAVVNRMLVVNGRAPLDAGTGLFQPD
VTKGQGIFSPALRQRSMMILAIWFLVSVSYYGVFTWMPAKLAGDGFGFVRGYGFLVLVAL
AQIPGYAIAAYGVEKWGRKPTLIGFCLLSALGCLLFTLASAGAMIAASLLIMSFALLGTW
GALYAFTPELYPTESRATGMGAAGAMARLGGLLAPSLLGYAIAQGFGVAIGIFAGLLVLA
AIAATMINAETRQVALT