Protein Info for Atu2253 in Agrobacterium fabrum C58

Annotation: MoxR family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 PF20030: bpMoxR" amino acids 28 to 205 (178 residues), 40.4 bits, see alignment E=3.6e-14 PF07726: AAA_3" amino acids 56 to 189 (134 residues), 200 bits, see alignment E=2.5e-63 PF07728: AAA_5" amino acids 57 to 187 (131 residues), 49.9 bits, see alignment E=6.8e-17 PF17863: AAA_lid_2" amino acids 263 to 327 (65 residues), 45.1 bits, see alignment E=1.4e-15

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 100% identity to atu:Atu2253)

Predicted SEED Role

"FIG017823: ATPase, MoxR family"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI43 at UniProt or InterPro

Protein Sequence (336 amino acids)

>Atu2253 MoxR family protein (Agrobacterium fabrum C58)
MGVMNTGETLDEKAIVASAEKALSDIAAIRTEVSKVIFGQEKVVQNTLLAILSGGHALLV
GVPGLAKTKLVTTLGTVLGLDANRIQFTPDLMPSDILGSEVMDQDENGRRSFRFIKGPIF
GQLLMADEINRASPRTQSALLQAMQEYHITMAGQTYELPKPFHVLATQNPLEQEGTYPLP
EAQLDRFLLQVDVDYPELAAERQILLDTTGTASGEARPVIGAERLMEIQALIRQMPVSDK
VVDAILSLVRSARPGHGNKLTDKNVVWGPGPRAGQSLMLTARARALYEGRLAPSLDDVHA
LAEPVLEHRMALTFAARAEGMSVRDVIAALVEQAKN