Protein Info for Atu2238 in Agrobacterium fabrum C58

Annotation: ubiquinol-cytochrome c reductase cytochrome b subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 44 to 70 (27 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 289 to 306 (18 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 370 to 396 (27 residues), see Phobius details PF00033: Cytochrome_B" amino acids 32 to 219 (188 residues), 239.6 bits, see alignment E=3.7e-75 PF13631: Cytochrom_B_N_2" amino acids 102 to 270 (169 residues), 152 bits, see alignment E=2.4e-48 PF00032: Cytochrom_B_C" amino acids 275 to 383 (109 residues), 143.1 bits, see alignment E=4.7e-46

Best Hits

Swiss-Prot: 68% identical to CYB_BLAVI: Cytochrome b (petB) from Blastochloris viridis

KEGG orthology group: K00412, ubiquinol-cytochrome c reductase cytochrome b subunit [EC: 1.10.2.2] (inferred from 100% identity to atu:Atu2238)

MetaCyc: 54% identical to cytochrome bc1 complex cytochrome b subunit (Arabidopsis thaliana col)

Predicted SEED Role

"Ubiquinol--cytochrome c reductase, cytochrome B subunit (EC 1.10.2.2)" in subsystem Ubiquinone Menaquinone-cytochrome c reductase complexes (EC 1.10.2.2)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.10.2.2

Use Curated BLAST to search for 1.10.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI51 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Atu2238 ubiquinol-cytochrome c reductase cytochrome b subunit (Agrobacterium fabrum C58)
MSGHSSYQPSTGIERWIDSRLPLPRMIYDSFVAYPVPRNLNYAYTFGAMLAVMLIVQILT
GVVLAMHYAAETTVAFNSVEKIMRDVNHGWLLRYMHANGASFFFIAVYLHIARGLYYGSY
KAPREILWILGCVIYLLMMATGFMGYVLPWGQMSFWGATVITGFFTAFPLVGEWIQQFLL
GGFAVDNPTLNRFFALHYLLPFMIAGVVILHIWALHVTGQTNPTGVEVKSKTDTVPFTPY
ATLKDALGVSVFLIAYAWFIFYMPNFLGHPDNYIMADPLKTPAHIVPEWYYLPFYAMLRA
ITFNVGPIDSKLGGVLVMFGAIIVLFFLPWLDTSKVRSAVYRPWYKMFFWLFVVNAILLG
WLGSRPAEGLYVVMSQIGTLYYFGFFLVIMPILGLVETPRRIPNSITEAVLEKKAAKTGA
APAAAQV