Protein Info for Atu2232 in Agrobacterium fabrum C58

Annotation: ATP-dependent Clp protease adaptor protein ClpS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF02617: ClpS" amino acids 20 to 98 (79 residues), 88 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 100% identical to CLPS2_AGRFC: ATP-dependent Clp protease adapter protein ClpS 2 (clpS2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2232)

Predicted SEED Role

"ATP-dependent Clp protease adaptor protein ClpS" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UD95 at UniProt or InterPro

Protein Sequence (103 amino acids)

>Atu2232 ATP-dependent Clp protease adaptor protein ClpS (Agrobacterium fabrum C58)
MSDSPVDLKPKPKVKPKLERPKLYKVMLLNDDYTPREFVTVVLKAVFRMSEDTGRRVMMT
AHRFGSAVVVVCERDIAETKAKEATDLGKEAGFPLMFTTEPEE