Protein Info for Atu2225 in Agrobacterium fabrum C58

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF26965: MimR_N" amino acids 2 to 184 (183 residues), 52.6 bits, see alignment E=7.2e-18 PF01590: GAF" amino acids 73 to 201 (129 residues), 41.8 bits, see alignment E=2.3e-14 PF02954: HTH_8" amino acids 276 to 316 (41 residues), 54.3 bits, see alignment 1.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2225)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI57 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Atu2225 transcriptional regulator (Agrobacterium fabrum C58)
MPTDIAHAERVYETARHRSAAASSPIIASWRRCMVKHRLAPEENRKPIFLSEIEFRRARE
SAAGLIAESTDELDRIFHSVGKSGCCLLLTDAQGVALERRGASGDDRDFRALGLWNGAVW
SEESVGTNGIGTALVDERSVVVYRDQHFFTSNTELCCTTAPIRDHTGRVTGALDISTCRD
DINEMTFSFVTQAVKDAAQRIEGNLFRRAFPGARIVVVPTGFGAAMSLLAVDQDDLVLGA
TRAARLALKLDDIRIAQGLPAADILQEQRHDGGSDLAEAERSALRRVLSRTNGNVTQAAS
LLGISRATLHRKMKKFDVH