Protein Info for Atu2223 in Agrobacterium fabrum C58

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 754 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 336 to 360 (25 residues), see Phobius details PF00672: HAMP" amino acids 357 to 408 (52 residues), 30.4 bits, see alignment 4e-11 PF00015: MCPsignal" amino acids 558 to 709 (152 residues), 159.1 bits, see alignment E=1e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to atu:Atu2223)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXK9 at UniProt or InterPro

Protein Sequence (754 amino acids)

>Atu2223 methyl-accepting chemotaxis protein (Agrobacterium fabrum C58)
MPGVNPTAVKAKSLSIKAKFAALVTGATLVSCLSVGLLSYEMGKSGLIDASEIRLETVAS
NQSKQLDAYTLRVEQSITELSQNAAIAQALETMTTVVPTEKDAIIQAFRREGVSEEERAS
FNGEGLRLLYAIRHATINAAIASVWRNTRVSDIYVIDKNGLIIYSVTKGKNFLTNVTEPQ
NAAIKDLFQRIEAGKDGVVSTTGFSGGDSDSAMIGMPLAVSNWGQLQRKGAVIMRVAADR
IGAVVTPEETGKTIDDAVLLSAEGKRRAGVLSGGADAAISENLAALSGASDPGMVLAQTP
AGNIFYAYRPVTVFGQKHLLAIGQQESKVLAAANDLAFWAAVATLAVLAIMTLIGIFVSA
SLTKPLTGLAGLMERLNGGDNNIEIKAVSRGDEIGTMARALESFRQGILDKQRMEAESHR
KGEELDEERAQREMEKARSAKELEEAVDALATGLANLAAGRLDRRIEKSFVPSLDHLRVD
FNNSMAGLEATISNIGESANAIRSGSGELKSASEDLSRRTERQAAALEEAAAALGEMTQA
VDLSLSRCNVAVEATAGTMQDAHKSTAVVKEAIVAMERIETSSSKIRQIIDVIDQIAFQT
NLLALNAGVEAARAGEAGKGFAVVAQEVRELAQKSAAAARDITTLIATSAGDVESGVALV
LKTGESLEQIQKRIQSVNDQIGEIATASREQSGRLSEINASVNELDHVTQQNAAMVEQTT
ASAFSLASEADGLTEQVGQFSVGETRHADQRYAA