Protein Info for Atu2205 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, MarR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF12802: MarR_2" amino acids 54 to 110 (57 residues), 52.4 bits, see alignment E=9.6e-18 PF01047: MarR" amino acids 57 to 110 (54 residues), 38.7 bits, see alignment E=1.5e-13 PF13463: HTH_27" amino acids 59 to 116 (58 residues), 32.5 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu2205)

Predicted SEED Role

"HTH-type transcriptional regulator PetP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI64 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Atu2205 transcriptional regulator, MarR family (Agrobacterium fabrum C58)
MPPQSLKTAAARQTPALPKVDDGKIDFDTIEALFFAYRDFVSDPDVILSKLDYGRAHHRV
VYFVSRQPGMTVADLLDTLQITKQSLARVLKQLIDDGYIRQMAGPEDRRQRRLYPTLTGR
ELALALSEPQSRRIDRALEGLGPDARACVRKFLAQMRSPTSVEGE