Protein Info for Atu2201 in Agrobacterium fabrum C58

Annotation: hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00753: Lactamase_B
  • amino acids 12 to 195 (184 residues), 121.6 bits, E=2.1e-39

Best Hits

Swiss-Prot: 49% identical to GLO22_ECOLI: Hydroxyacylglutathione hydrolase GloC (gloC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to atu:Atu2201)

MetaCyc: 49% identical to hydroxyacylglutathione hydrolase GloC (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]

Predicted SEED Role

"Zn-dependent hydrolase"

MetaCyc Pathways

• methylglyoxal degradation VIII (3/3 steps found)
• methylglyoxal degradation I (2/3 steps found)
• superpathway of methylglyoxal degradation (5/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

See A9CI65 at UniProt or InterPro

Protein Sequence (214 amino acids)

>Atu2201 hydrolase (Agrobacterium fabrum C58)
MGKLQAGIIPVTPFEQNCTILFDQDTKEGVVVDPGGDVDVILQVVAENGITLKAIWLTHG
HLDHAGGADELREKLSLSVIGPHEHDRPLLERIEVQAQKYGISGLKNVEPDSWLKDGDKV
SFGDHVFEVYHCPGHAPGHVIYYNRDQNFAHVGDVLFSGSVGRTDLPGGNHEQLMASIRD
KLLPLGDDVGFICGHGPGGRLGEERLNNPYLKGL