Protein Info for Atu2183 in Agrobacterium fabrum C58

Annotation: lipopolysaccharide core biosynthesis mannosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF20706: GT4-conflict" amino acids 167 to 323 (157 residues), 43 bits, see alignment E=4.7e-15 PF00534: Glycos_transf_1" amino acids 169 to 319 (151 residues), 103.6 bits, see alignment E=1.3e-33 PF13692: Glyco_trans_1_4" amino acids 170 to 313 (144 residues), 104.8 bits, see alignment E=7.1e-34

Best Hits

Swiss-Prot: 70% identical to LPCC_RHILV: Lipopolysaccharide core biosynthesis mannosyltransferase LpcC (lpcC) from Rhizobium leguminosarum bv. viciae

KEGG orthology group: K12989, mannosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to atu:Atu2183)

MetaCyc: 64% identical to LPS core oligosaccharide mannosyltransferase WadC (Brucella abortus 2308)
2.4.1.-

Predicted SEED Role

"Glycosyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CI75 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Atu2183 lipopolysaccharide core biosynthesis mannosyltransferase (Agrobacterium fabrum C58)
MSHVSLKDVQVLAPNFKRRLSGVTSTIVQLIPVQNRLGQKVGTIGPGLPPHLPHVRFRDL
WRLWQNGPSGGPRIWHARRNLEMLPGIFMRDVLRMKVKLLFTSAAQRRHSAYTRFLISKM
DAVVATSTRSGSFLEVPHRVVMHGVDTELFHPATGPEDTIAATGLPGHYLLGCFGRVRHQ
KGTDLFVRAMIELLPHYPQWTAVVSGRVTAEHKAFGDTLKADVAAAGLTDRIIFQGEVDD
IKPWYRRLTLYVAPSRNEGFGLTPLEAMASETAVVASNAGAYEEMIVTGETGWVVGAGDY
ASLRDAIKTYLADPALAKAHASAGLAHVRSTFPLEKEATCLGEVYEALQRG