Protein Info for Atu2173 in Agrobacterium fabrum C58

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 696 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 277 to 303 (27 residues), see Phobius details PF02743: dCache_1" amino acids 40 to 260 (221 residues), 92.5 bits, see alignment E=6.1e-30 PF22673: MCP-like_PDC_1" amino acids 89 to 180 (92 residues), 44.6 bits, see alignment E=3.5e-15 PF00672: HAMP" amino acids 297 to 345 (49 residues), 27.2 bits, see alignment 7.8e-10 PF00015: MCPsignal" amino acids 495 to 647 (153 residues), 171.6 bits, see alignment E=2.9e-54

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to atu:Atu2173)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXP8 at UniProt or InterPro

Protein Sequence (696 amino acids)

>Atu2173 methyl-accepting chemotaxis protein (Agrobacterium fabrum C58)
MPKKTNLMTRILVAASSLVVAAFAGFSYYIDSLQHRVTTEAVAENIDSSGKQAAQSIANW
LNGRIMLTQTVAATLAKLPDDEAKLRFLENDVLTAQFMSTYFGNAETGTFTTFPKTPLPE
GYDPRKRPWYLDAVKAGKTVLTEPYNDASTGGLIITAAIPVSIDGKLAGVTGSDFSLDSL
VKMIKSVDAGTDGYAFLVSKDGKILIHPDPKFVDKPLADLFKVDTPAISSAISQTEIDGK
GKITSFIPVAGLPSVDWYLGFVVDSDVAYSAIGQFRLAATIATVLAAAIMIGLLATVLSR
FIVRPVTQMTSAMEGLAAGNLDVGIPGQERTDQIGSMAAAVAVFRSNAMERLRLEGDAEQ
NRTLSEQERNERERTAAKDAADIQFAVDSLAKGLAHLSDGDLNYRIDTPFVTRIDRLRND
FNNSVAKLNAALSTVGQNALAIDAGAGEIRQSADDLARRTEQQAASVEETAAALEEITTT
VKDSARRAEEVGRLVDRARGNAEQSGVIVEDAVRAMEGIEKSSSEISNIIGVIDEIAFQT
NLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKAIKTLINASTSQVQSGVELV
GNAGKALETIVREVQEINRHIDAIVTSSREQSTGLQEINTAINTIDQGTQQNAAMVEEQT
AASHGLASEAAALNELLAQFQLAAATRRQAEYGRAA