Protein Info for Atu2172 in Agrobacterium fabrum C58

Annotation: multidrug efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 368 to 393 (26 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details PF01554: MatE" amino acids 30 to 189 (160 residues), 97.9 bits, see alignment E=2.7e-32 amino acids 256 to 422 (167 residues), 84 bits, see alignment E=5e-28 TIGR00797: MATE efflux family protein" amino acids 30 to 435 (406 residues), 252.3 bits, see alignment E=3.9e-79

Best Hits

Swiss-Prot: 100% identical to NORM_AGRFC: Probable multidrug resistance protein NorM (norM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 100% identity to atu:Atu2172)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UDF5 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Atu2172 multidrug efflux protein (Agrobacterium fabrum C58)
MSSSVVAETVPSGSGSWFSHFKATLVLGIPLIGAQLAQLGIHTTDMVIVGQLGAEKLAAM
VLAGQFFFVVFIFGSGFSVAVVPMVAQAYGQGDATSARRSLRMGMWVAIAYWLLALPIFF
NAERILVYLGQNPNVAALTGHYLAIAKFGLLPALLFYVLRGLVSAIGRAGIILYVTIIML
VMNGLMAYVLVFGHFGLPAMGMNGAAVVAVIVNAFSFIFIVAYVQTREETKKYELFVRFW
RPDWHALFEVLRLGLPISITILAEVTLFAAASILMGQIGTVQLAAHGIALQLASIAFMIP
LGLSQAATVRVGVARGQGDFKNLIRASIMIYAIACGIALCGGILFAAVPEFLAKWFLDPK
LPEAAEVLAYASSLVVIAGIFQLVDGIQAVTAGLLRGLKDARIPAMLALISYWPIGLALA
WTMAFPLGFGGRGVWFGFVIGLSTAAVLLTVRFVLLVKREMKTAR