Protein Info for Atu2148 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 117 to 140 (24 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 230 to 251 (22 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 127 to 289 (163 residues), 30.9 bits, see alignment E=1.1e-11

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to atu:Atu2148)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXR9 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Atu2148 ABC transporter, membrane spanning protein (Agrobacterium fabrum C58)
MPSNNTGGPSDAGRKLPLNWIGVVPFAVFVMLFLILPTMKIVIGAFQQTDGSFTLDNIAG
LFTSSILAAYWISIKISLASAALGCLIGFAVAAAVVLGGLPQRIRGPLLTFSGVASQFAG
VPLAFAFIATLGPVGLLTVFLKTQIGIDLRLLGFNILSFWGLTVTYLFFQIPLMILIITP
ALDGLKREWREAAEILGATGLQYWRMVAFPILLPSLLGTMSLLFANAFGAVATAIALTGS
SLNIVPILLFAQIRGDVLGNPHLGYALAFGMIVLTGIANALYIWLRARSERWLK