Protein Info for Atu2115 in Agrobacterium fabrum C58

Annotation: pyrophosphate--fructose-6-phosphate 1-phosphotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 61% identical to PFP_METMH: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (pfp) from Methylomonas methanica

KEGG orthology group: K00895, pyrophosphate--fructose-6-phosphate 1-phosphotransferase [EC: 2.7.1.90] (inferred from 100% identity to atu:Atu2115)

Predicted SEED Role

No annotation

MetaCyc Pathways

superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (20/22 steps found)
glycolysis IV (9/10 steps found)
pentose phosphate pathway (non-oxidative branch) II (6/6 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.90

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXV0 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Atu2115 pyrophosphate--fructose-6-phosphate 1-phosphotransferase (Agrobacterium fabrum C58)
MAKQKVAMLTAGGLAPCLSSAVGGLIERYSDIAPEIDIIAYRSGYQGVLLGERIEITKDM
REKAHLLHRYGGSPIGNSRVKLTNAADCAKRGLVKEGDNPLRVAAERLAADGITILHTIG
GDDTNTTAADLAAYLGANGYDLTVVGLPKTVDNDVVPIKQSLGAWTAAEVGAAFFDNVSN
EQSAAPKTFVIHEVMGRHCGWLTAATARAYIQKTRGNDYVEGLMMNTQMKNIDGIYLPEM
AFDIEAEAERLKEVMDKHGYVTLFVSEGAGLDAIVAEREAAGEAVKRDAFGHVKIDTINV
GGWFQKQFAGLIGAERSMVQKSGYFARSAPANGDDLRLIQGMVDLAVESALNKVSGVTGH
DEDQNGKLRTIEFPRIKGGKHFDLSAKWFTEVMEHVGQPFTAA