Protein Info for Atu2093 in Agrobacterium fabrum C58

Annotation: UDP-N-acetylmuramate-alanine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01082: UDP-N-acetylmuramate--L-alanine ligase" amino acids 10 to 458 (449 residues), 548.2 bits, see alignment E=8.7e-169 PF01225: Mur_ligase" amino acids 10 to 106 (97 residues), 110.9 bits, see alignment E=4.9e-36 PF08245: Mur_ligase_M" amino acids 112 to 298 (187 residues), 100.6 bits, see alignment E=1.8e-32 PF02875: Mur_ligase_C" amino acids 320 to 450 (131 residues), 80.8 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 100% identical to MURC_AGRFC: UDP-N-acetylmuramate--L-alanine ligase (murC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01924, UDP-N-acetylmuramate--alanine ligase [EC: 6.3.2.8] (inferred from 100% identity to atu:Atu2093)

Predicted SEED Role

"UDP-N-acetylmuramate--alanine ligase (EC 6.3.2.8)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UDM9 at UniProt or InterPro

Protein Sequence (471 amino acids)

>Atu2093 UDP-N-acetylmuramate-alanine ligase (Agrobacterium fabrum C58)
MKMPKAIGLVHFIGIGGIGMSGIAEVLHNLGHRVQGSDQADSANVQRLRDKGIEVFVGHT
ADNLGDAEVVVVSTAIKKNNPELIAAREKHLPIVRRAEMLAELMRFRNAIAIGGTHGKTT
TTSMVATLLEAGNLDPTVINGGIINAYGTNARMGEGEWMVVEADESDGTFLKLPADVAVI
TNIDPEHLDHYGNFDAVRAAFRQFVENVPFYGFGVMCLDHPEVQALVGRIEDRKVITYGE
NPQADVRFSNVRIDGTRSIFDVEIRRRRTGKIFSFKDLVLPMPGRHNVSNATAAIAVANR
LGISEADIKKGLASFAGVKRRFTLTGEANGVQVFDDYGHHPVEIKAVLAAAREACKGRII
AVHQPHRYSRLSSLFDDFAHCFNDADTILLAPVYAAGEDPIEGASSEALVSAIKAAGHRD
ARFLEKREDLASQVAAIANPGDFVVLLGAGNITQWAAALPSELKSISGKSE