Protein Info for Atu2085 in Agrobacterium fabrum C58

Annotation: UDP-3-0-(3-hydroxymyristoyl) N-acetylglucosamine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF03331: LpxC" amino acids 9 to 282 (274 residues), 333.7 bits, see alignment E=4.6e-104 TIGR00325: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase" amino acids 9 to 294 (286 residues), 305.9 bits, see alignment E=1.6e-95

Best Hits

Swiss-Prot: 45% identical to LPXC_SHEPW: UDP-3-O-acyl-N-acetylglucosamine deacetylase (lpxC) from Shewanella piezotolerans (strain WP3 / JCM 13877)

KEGG orthology group: K02535, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [EC: 3.5.1.-] (inferred from 100% identity to atu:Atu2085)

MetaCyc: 42% identical to UDP-3-O-acyl-N-acetylglucosamine deacetylase (Escherichia coli K-12 substr. MG1655)
UDPACYLGLCNACDEACETYL-RXN [EC: 3.5.1.108]

Predicted SEED Role

"UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase (EC 3.5.1.108)" (EC 3.5.1.108)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXW9 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Atu2085 UDP-3-0-(3-hydroxymyristoyl) N-acetylglucosamine deacetylase (Agrobacterium fabrum C58)
MTIGLLGFQTTIAHAVQLKGIGVHSGNPVSMTFQPAEAGTGILFQRLHDNGSVTELKAVS
ANVGNTDLCTVLGRSLSQSVATIEHVMAAIYAMGLDNLIVEVDGPEVPIMDGSSAPFIEA
IESVGIKNLGVKRRYIRVTKPVRIDSGASWAEFRPYDGTRFEVDIDFDTPLIGRQSWKGD
LTAETFKNELSRARTFGFMRDVERLWAAGYALGSSLENSVVISDDNSVINMEGLRYAKDE
FVRHKTLDAVGDLALAGAQFIGCYRSYRGGHKVNANALKALLSDPSAYEIVEAPAARNQV
RAREFVAVNMPEFAPWSA