Protein Info for Atu2072 in Agrobacterium fabrum C58

Annotation: ribosomal protein L11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06325: PrmA
  • amino acids 50 to 291 (242 residues), 209.2 bits, E=3.8e-65
• PF01135: PCMT
  • amino acids 119 to 254 (136 residues), 24.7 bits, E=7.6e-09
• PF05175: MTS
  • amino acids 146 to 228 (83 residues), 35.7 bits, E=2.6e-12
• PF13489: Methyltransf_23
  • amino acids 148 to 263 (116 residues), 27.1 bits, E=1.2e-09
• PF10294: Methyltransf_16
  • amino acids 149 to 227 (79 residues), 25.2 bits, E=5e-09
• PF13847: Methyltransf_31
  • amino acids 154 to 230 (77 residues), 28.6 bits, E=4.4e-10
• PF13649: Methyltransf_25
  • amino acids 156 to 249 (94 residues), 27.6 bits, E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to PRMA_AGRFC: Ribosomal protein L11 methyltransferase (prmA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02687, ribosomal protein L11 methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to atu:Atu2072)

Predicted SEED Role

"Ribosomal protein L11 methyltransferase (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended or Ribosome biogenesis bacterial (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q8UDP9 at UniProt or InterPro

Protein Sequence (292 amino acids)

>Atu2072 ribosomal protein L11 methyltransferase (Agrobacterium fabrum C58)
MSEIRLYVTTTEIKAGEILDLMSDYFGEEDVAIATTEVDEKRDIWEASVYLMAEQEEEFR
ERVSTLLAPAFPGLVIEKEIIPDVDWIAKSLEGLKPVRAGRFIVHGAHDRDKVQPHDLAI
EIEAGQAFGTGHHGTTAGCLEMIEDVLRARKVRNALDLGTGSGVLAIAVRKMRPIPVLAT
DIDPIAVKVAKENVRLNGIVSGMALETAPGFHSDAFRKHGPFDLIIANILARPLIKMAPQ
LVTHLAPGGTVILSGILASQRWKVLSAYNGAKLSHIRTIWRNDWVTLHLRKD