Protein Info for Atu2060 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (glycine betaine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03414: choline ABC transporter, periplasmic binding protein" amino acids 18 to 306 (289 residues), 432.2 bits, see alignment E=4.7e-134 PF04069: OpuAC" amino acids 27 to 277 (251 residues), 190.5 bits, see alignment E=2.1e-60

Best Hits

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to atu:Atu2060)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CXZ0 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Atu2060 ABC transporter, substrate binding protein (glycine betaine) (Agrobacterium fabrum C58)
MKVVSAAALVLAGESPAFAADADACKMVRMAEPGWNDLAFTTGIAMTLLKSLHYQPQSQL
LGIDVIYTSLKSKDLDVFMGYWDPAMVNYYKPYKEDGSVEKVRTNLVGAKYTFAVPTYVW
EAGVKDFSDLQKFADKFDRKLYGIEPGSNQLMLDAVKDPALGLKDWEVVESSEQGMLSQV
ARFNRNKTFIVFQGWAPHPMNAKFDIKYLTGGDKFYGPDFGAATVDTQVRRGYLQECPNV
AKLLQNLEFDVEFENKGMDLIMNGGLSPEDAAAQAIKAEPHRLETWLKDVFALDGQNGLA
TVKAALGL