Protein Info for Atu2001 in Agrobacterium fabrum C58

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 988 TIGR00631: excinuclease ABC subunit B" amino acids 172 to 829 (658 residues), 1010.6 bits, see alignment E=0 PF04851: ResIII" amino acids 179 to 285 (107 residues), 45.5 bits, see alignment E=2.8e-15 PF00270: DEAD" amino acids 183 to 249 (67 residues), 25.5 bits, see alignment 3.5e-09 PF17757: UvrB_inter" amino acids 326 to 415 (90 residues), 114.6 bits, see alignment E=6.4e-37 PF27431: UvrB_3rd" amino acids 421 to 481 (61 residues), 97.1 bits, see alignment 1.6e-31 PF00271: Helicase_C" amino acids 605 to 711 (107 residues), 67.3 bits, see alignment E=4.9e-22 PF12344: UvrB" amino acids 718 to 759 (42 residues), 77.4 bits, see alignment (E = 2.1e-25) PF02151: UVR" amino acids 799 to 830 (32 residues), 34.5 bits, see alignment (E = 4.5e-12)

Best Hits

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to atu:Atu2001)

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CY37 at UniProt or InterPro

Protein Sequence (988 amino acids)

>Atu2001 excinuclease ABC subunit B (Agrobacterium fabrum C58)
MARSPKNPPSSRQGFEEAPQSSFEGAPLGGSVADWVKQLEAEAEAGSVETQREIASKAGK
HRKKIEIEARKEAEKAANKTAKNTTASKTARGVSIGASSDPKTRAAAGLNPVAGMDVSLE
EAANLAPGAVTATVEALSALIESGNPLFKDGKMWTPHRPARPPKSEGGVTIRMDSEYQPA
GDQPTAIADLVEGINSGERSQVLLGVTGSGKTFTMAKVIEATQRPAVILAPNKTLAAQLY
SEFKNFFPDNAVEYFVSYYDYYQPEAYVPRSDTFIEKESSINEQIDRMRHSATRSLLERD
DCIIVASVSCIYGIGSVETYTAMTFQMQVGDRLDQRQLLADLVAQQYKRRDMDFQRGSFR
VRGDTIEIFPAHLEDAAWRISMFGDEIDSITEFDPLTGQKTGDLQSVKIYANSHYVTPRP
TLNGAIKSIKEELKVRLAELEKAGRLLEAQRLEQRTRYDIEMLEATGSCAGIENYSRYLT
GRNPGEPPPTLFEYIPDNALLFIDESHVSVSQIGGMYRGDFRRKATLAEYGFRLPSCMDN
RPLRFEEWDAMRPLTVAVSATPGSWEMEQSGGVFAEQVIRPTGLIDPPVEVRSARSQVDD
VLGEIRETAAKGYRTLCTVLTKRMAEDLTEYLHEQGVRVRYMHSDIDTLERIEIIRDLRL
GAFDVLVGINLLREGLDIPECGFVAILDADKEGFLRSETSLIQTIGRAARNVDGKVILYA
DNITGSMKRAMEETSRRREKQMAYNAEHGITPESVKAKISDILDSVYERDHVRADISGVS
GKGFADGGHLVGNNLQAHLNALEKSMRDAAADLDFEKAARLRDEIKRLKAAELATMDDPM
AKEEARAIEGSGKSSKRRNESVSPLEGEMSGRTEGGNAPNESSNSLFAKPSLDEMGPGSD
AGKPLFRRNSLDEMTVGRTEKPVRGAVPDKPGTEAGKRFSPLLEGQPERAADDPRPLVRG
KIGAGSYEDAGEQKRKSRTKGKTGRPGR