Protein Info for Atu1932 in Agrobacterium fabrum C58

Annotation: 30S ribosomal protein S8

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF00410: Ribosomal_S8" amino acids 5 to 132 (128 residues), 160.6 bits, see alignment E=9.2e-52

Best Hits

Swiss-Prot: 100% identical to RS8_AGRFC: 30S ribosomal protein S8 (rpsH) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02994, small subunit ribosomal protein S8 (inferred from 99% identity to agr:AGROH133_07141)

MetaCyc: 47% identical to 30S ribosomal subunit protein S8 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S8p (S15Ae)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UE32 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Atu1932 30S ribosomal protein S8 (Agrobacterium fabrum C58)
MTMTDPLGDMLTRIRNGAARRKSSVSTPASSLRARVLDVLQSEGYIRGYSKVDFENGKAE
FTIELKYYEGASVIREIGRVSKPGRRVYVSVKSIPQVANGLGITILSTPKGVMADHQARE
QNVGGEVLCSVF