Protein Info for Atu1908 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 7 to 44 (38 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 184 to 208 (25 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details PF01925: TauE" amino acids 14 to 266 (253 residues), 157.6 bits, see alignment E=2.3e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1908)

Predicted SEED Role

"Bll0510 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIG5 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Atu1908 hypothetical protein (Agrobacterium fabrum C58)
MPPVSEILVFAAALAAAGVVAGLLAGLFGIGGGAVLVPVFYHVFGLLDVPEAVRMHLSLG
TSLAIIVPTSVRSFLTHRQKGAVDIDLLKGWIVAVPLGTILASVVAAYASSVALRLIFAF
IALALAFRMIVNRASWQLGSDLPKNPARFLVGTGIGLLSGLMGVGGGVMNNTFMTLYGRT
IHQAVATSSGVGVLISLPGLLGYIWAGWGNAGLPPFSTGFINWIAVVLLIPITLLVAPYG
VRLAHALSKKQLERAFGVFLVFVAAQFFYSVYG