Protein Info for Atu1901 in Agrobacterium fabrum C58

Annotation: transketolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF13292: DXP_synthase_N" amino acids 1 to 178 (178 residues), 42.5 bits, see alignment E=1e-14 PF00456: Transketolase_N" amino acids 8 to 249 (242 residues), 156.5 bits, see alignment E=1.8e-49 PF00676: E1_dh" amino acids 106 to 216 (111 residues), 24.8 bits, see alignment E=2.1e-09 PF02775: TPP_enzyme_C" amino acids 112 to 174 (63 residues), 24.3 bits, see alignment E=4.8e-09

Best Hits

Swiss-Prot: 47% identical to APTA_BACV8: Apulose-4-phosphate transketolase subunit A (aptA) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K00615, transketolase [EC: 2.2.1.1] (inferred from 100% identity to atu:Atu1901)

MetaCyc: 50% identical to apulose-4-phosphate transketolase subunit A (Actinobacillus succinogenes 130Z)
RXN-20930 [EC: 2.2.1.13]

Predicted SEED Role

"Transketolase, N-terminal section (EC 2.2.1.1)" in subsystem Calvin-Benson cycle or Pentose phosphate pathway (EC 2.2.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.1

Use Curated BLAST to search for 2.2.1.1 or 2.2.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIH1 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Atu1901 transketolase (Agrobacterium fabrum C58)
MQSQELERIARQIRLRDVQAVFEAGAGHVGGEMSAIDIMTALYFRVLRIWPNDPKNPARD
RFVLSKGHTACALYVTLAKRGFIPEEEISTFLQPNSRLNGHPNCNKVPGVETNTGPLGHG
LPVAVGMATAAKLSGEDYHTYVMTGDGEMQEGSNWEAIMSAAQFKLNNLTLVIDHNRFQQ
GAAIADTNDVAPLRPKLEAFGWEVTEINGNAMAEVVPALEHRGNRPHCIVAHTNKGHGIS
FMQDRVDWHHKVPSKEQYEIAVKELSEAL