Protein Info for Atu1891 in Agrobacterium fabrum C58

Annotation: cobalamin biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 69 to 86 (18 residues), see Phobius details amino acids 115 to 138 (24 residues), see Phobius details amino acids 145 to 165 (21 residues), see Phobius details amino acids 192 to 227 (36 residues), see Phobius details TIGR00317: cobalamin 5'-phosphate synthase" amino acids 12 to 257 (246 residues), 113.6 bits, see alignment E=6.6e-37 PF02654: CobS" amino acids 14 to 255 (242 residues), 178.6 bits, see alignment E=9.1e-57

Best Hits

Swiss-Prot: 51% identical to COBS_SINMW: Adenosylcobinamide-GDP ribazoletransferase (cobS) from Sinorhizobium medicae (strain WSM419)

KEGG orthology group: K02233, adenosylcobinamide-GDP ribazoletransferase [EC: 2.7.8.26] (inferred from 100% identity to atu:Atu1891)

MetaCyc: 49% identical to adenosyl-cobalamin (5'-phosphate) synthase (Pseudomonas denitrificans (nom. rej.))
Adenosylcobinamide-GDP ribazoletransferase. [EC: 2.7.8.26]; 2.7.8.26 [EC: 2.7.8.26]

Predicted SEED Role

"Cobalamin synthase (EC 2.7.8.26)" (EC 2.7.8.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIH5 at UniProt or InterPro

Protein Sequence (261 amino acids)

>Atu1891 cobalamin biosynthesis protein (Agrobacterium fabrum C58)
MKAGDFITDVMHSVAFLSRLPVPSRFFGEGDGASMRRTARAFPAAGLLIALPAAFLVVIF
ATFDASPQLTGWLAIGLTALITGALHEDGLADMADGFGSGKDKARMLEIMKDSRIGSYGT
IAMVLSFALRATALASLIETLPGKTAAACLIATLVMSRALMVWHWQALPAAKTSGIAAGA
GQPGESDRNIALVTGLLVFILFTLHALPILSIALVMAAAILATVLFGRLCDRKIGGHTGD
TIGACQQITEIVTLVALALAA