Protein Info for Atu1888 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 transmembrane" amino acids 58 to 79 (22 residues), see Phobius details amino acids 85 to 103 (19 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details PF00512: HisKA" amino acids 261 to 330 (70 residues), 75.2 bits, see alignment E=3.3e-25 PF02518: HATPase_c" amino acids 377 to 487 (111 residues), 82.2 bits, see alignment E=3.7e-27

Best Hits

KEGG orthology group: K07716, two-component system, cell cycle sensor histidine kinase PleC [EC: 2.7.13.3] (inferred from 100% identity to atu:Atu1888)

Predicted SEED Role

"Sensor histidine kinase (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIH7 at UniProt or InterPro

Protein Sequence (511 amino acids)

>Atu1888 two component sensor kinase (Agrobacterium fabrum C58)
MSKSVSTSTDKIIVDRSKKHRNKAVFDTVKTTRERLQQGAGGNEAYEREMLTMHIAEALQ
GAMIMPLFIVLASIIGLYITGDISLIIWSLIALSFHAMSLVLAKRAAKQAITDDNLQHWK
NLFLGMQILIGCAWAMFALAEPVRNDPTLVLFFKGSTLLIALSLTAMANFMLRRATFMTF
LPVLAALCITSAISRDPFDVGLALMFGMAILFCHRITSRLYQTSIKLLSSQTEKDDLIAE
LEVANSVSDEARRRAEEANLAKSRFLASMSHELRTPLNAILGFSEVMSSEVLGPLNNPLY
KEYSGDIHRSGQHLLDLINEILDLSRIEAGRYDLNEESISMLEIAEDCIGMIQLRARAKN
IRISQQFEASLPQVWADEKSIRQVILNLLSNAVKFTPQGGEILVKAGWTAGGGQYVSIRD
NGPGIPEDEIPVVLSAFGQGSIAIKSAEQGTGLGLPIVQAILAKHDGQFILKSKLREGTE
GIAILPAKRVLQSLPAVEETHAIQPRRRSFA