Protein Info for Atu1874 in Agrobacterium fabrum C58

Annotation: RecA protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR02012: protein RecA" amino acids 15 to 335 (321 residues), 576.4 bits, see alignment E=8.8e-178 PF00154: RecA_N" amino acids 18 to 280 (263 residues), 488.5 bits, see alignment E=1.3e-150 PF08423: Rad51" amino acids 48 to 238 (191 residues), 31.9 bits, see alignment E=2.1e-11 PF06745: ATPase" amino acids 52 to 241 (190 residues), 34.6 bits, see alignment E=3.3e-12 PF27531: MT3502_N" amino acids 65 to 164 (100 residues), 31.7 bits, see alignment E=4.1e-11 PF21096: RecA_C" amino acids 283 to 338 (56 residues), 88 bits, see alignment E=8.8e-29

Best Hits

Swiss-Prot: 100% identical to RECA_AGRFC: Protein RecA (recA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03553, recombination protein RecA (inferred from 100% identity to atu:Atu1874)

MetaCyc: 72% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33156 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Atu1874 RecA protein (Agrobacterium fabrum C58)
MAQNSLRLVEDKSVDKSKALEAALSQIERSFGKGSIMKLGSNENVVEVETVSTGSLSLDI
ALGIGGLPKGRIIEIYGPESSGKTTLALQTIAEAQKKGGICAFVDAEHALDPVYARKLGV
DLQSLLISQPDTGEQALEITDTLVRSGAVDVLVIDSVAALTPRAEIEGEMGDSLPGLQAR
LMSQALRKLTASISKSKCMVIFINQIRMKIGVMFGSPETTTGGNALKFYASVRLDIRRIG
AVKEREEVVGNQTRVKVVKNKMAPPFKQVEFDIMYGEGVSKTGELVDLGVKAGIVEKSGA
WFSYNSQRLGQGRENAKTFLRDNPDTANEIELALRQNAGLIADRFLQNGGPDAGEGDDGS
DEG