Protein Info for Atu1855 in Agrobacterium fabrum C58

Annotation: MFS permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 334 to 359 (26 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 7 to 385 (379 residues), 254.7 bits, see alignment E=1e-79 PF07690: MFS_1" amino acids 9 to 354 (346 residues), 143.6 bits, see alignment E=7.7e-46 PF00083: Sugar_tr" amino acids 45 to 184 (140 residues), 27.5 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 100% identity to atu:Atu1855)

Predicted SEED Role

"MFS family multidrug efflux protein, similarity to bicyclomycin resistance protein Bcr"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYD5 at UniProt or InterPro

Protein Sequence (402 amino acids)

>Atu1855 MFS permease (Agrobacterium fabrum C58)
MGRTEFIGLAAMLMALNALAIDIMLPGLQEIGASLGVVNENHRQYVISTYLLGFGIAQLL
YGPISDRFGRRKPMLVGLAIYIISAIAVVFVPSFTGLLVLRFIQGIGSAATRVITISIVR
DIYGGRQMAEVMSLIMMVFMVVPVIAPGTGQIVLFFGDWHLIFAFMAGIAAVVTAWMYFR
LPETLHPDDVRPFTARSILGGFKIVLTNRIALCYTLSSTFIFGALFGFINSAEQVYKGIY
GLGAWFAAAFAGVALFMAFSSFINARLVGRFGMRKLSHGSLLGFIAITFVWLLVQILGPE
PMPFAIFIVFFALAMFQFGWIGSNFNSLAMEPLGHVAGTASSVIGFMGTVGGSLIGAGIG
QAFDGTALPMVAGFFAVSIIGLIFVLIGEKGVLFQAHNKPTR