Protein Info for Atu1845 in Agrobacterium fabrum C58

Annotation: phosphoribosylformylglycinamidine synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 TIGR01737: phosphoribosylformylglycinamidine synthase I" amino acids 2 to 202 (201 residues), 288 bits, see alignment E=2.2e-90 PF00117: GATase" amino acids 14 to 82 (69 residues), 24.6 bits, see alignment E=3.7e-09 PF07685: GATase_3" amino acids 15 to 78 (64 residues), 34.6 bits, see alignment E=3.2e-12 PF13507: GATase_5" amino acids 17 to 187 (171 residues), 115.5 bits, see alignment E=4.6e-37 PF01965: DJ-1_PfpI" amino acids 24 to 85 (62 residues), 28.1 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 86% identical to PURQ_RHIME: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 100% identity to atu:Atu1845)

MetaCyc: 52% identical to phosphoribosylformylglycinamidine synthetase subunit I (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIJ8 at UniProt or InterPro

Protein Sequence (207 amino acids)

>Atu1845 phosphoribosylformylglycinamidine synthase I (Agrobacterium fabrum C58)
MIAALTKISGQAPVTIWQTETDIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQAIREKA
EQGVKVLGVCNGFQILVEAGMLPGALMRNASLKFVCREVKLEVANNDTEFTRAYDRGQIL
RCPVAHHDGNYFLDTDELKSVEDNRQVVFRYAEGTNPNGSLNDIAGVINAKGNVLGMMPH
PENLIEAAHGGNDGRGLFASALGVIAA