Protein Info for Atu1844 in Agrobacterium fabrum C58

Annotation: Phosphoribosylformylglycinamidine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 PF02700: PurS" amino acids 3 to 78 (76 residues), 113.5 bits, see alignment E=2.1e-37 TIGR00302: phosphoribosylformylglycinamidine synthase, purS protein" amino acids 3 to 79 (77 residues), 101.4 bits, see alignment E=1.2e-33

Best Hits

Swiss-Prot: 44% identical to PURS_METJA: Phosphoribosylformylglycinamidine synthase subunit PurS (purS) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 100% identity to atu:Atu1844)

MetaCyc: 48% identical to factor required for phosphoribosylformylglycinamidine synthetase activity (Bacillus subtilis subtilis 168)
Phosphoribosylformylglycinamidine synthase. [EC: 6.3.5.3]

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEB6 at UniProt or InterPro

Protein Sequence (80 amino acids)

>Atu1844 Phosphoribosylformylglycinamidine synthetase (Agrobacterium fabrum C58)
MIKARVTVTLKNGVLDPQGKAIEGALGSLGFDGVGHVRQGKVFDLELEGADKAKAETDLK
AMCEKLLANTVIENYAISIL