Protein Info for Atu1841 in Agrobacterium fabrum C58

Annotation: adenylosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 transmembrane" amino acids 223 to 241 (19 residues), see Phobius details TIGR00928: adenylosuccinate lyase" amino acids 1 to 432 (432 residues), 503.4 bits, see alignment E=2.6e-155 PF00206: Lyase_1" amino acids 7 to 287 (281 residues), 181 bits, see alignment E=4.1e-57 PF10397: ADSL_C" amino acids 353 to 431 (79 residues), 89.6 bits, see alignment E=1.3e-29

Best Hits

Swiss-Prot: 53% identical to PUR8_BACSU: Adenylosuccinate lyase (purB) from Bacillus subtilis (strain 168)

KEGG orthology group: K01756, adenylosuccinate lyase [EC: 4.3.2.2] (inferred from 100% identity to atu:Atu1841)

Predicted SEED Role

"Adenylosuccinate lyase (EC 4.3.2.2)" in subsystem De Novo Purine Biosynthesis or Purine conversions (EC 4.3.2.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIJ9 at UniProt or InterPro

Protein Sequence (435 amino acids)

>Atu1841 adenylosuccinate lyase (Agrobacterium fabrum C58)
MIPRYSRPEMVAIWSPETKFRIWFEIEAHACDALAELGVIPKSAAQTIWEKGGSATFDVA
RIDEIEAVTKHDVIAFLTHLAEFVGPDSRFVHQGMTSSDVLDTTLNIQLVRAADLLLADI
DRVLAALKTRAFEHKNTVRIGRSHGIHAEPTTMGLTFARFYAEMHRNRERLVNARAEIAT
GAISGAVGTFANIDPRVEEHVCEKLGLIPEPVSTQVIPRDRHAMFFAVLGVIASSIENVA
IEIRHMQRTEVLEAEEFFSPGQKGSSAMPHKRNPVLTENLTGLARLVRMSVVPAMENVAL
WHERDISHSSVERAIGPDTTVTLDFALNRLAGVIEKLVIYPDNMLKNMNKFRGLVHSQRV
LLALTQAGVSREDAYRLVQRNAMRVWEQGADFLEELLGDEEVRAALPEDVIREKFDLGYH
TKHVDTIFTRVFGKA