Protein Info for Atu1828 in Agrobacterium fabrum C58

Annotation: tyrosyl-tRNA synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 TIGR00234: tyrosine--tRNA ligase" amino acids 7 to 414 (408 residues), 381.1 bits, see alignment E=3.6e-118 PF00579: tRNA-synt_1b" amino acids 34 to 328 (295 residues), 259 bits, see alignment E=8.9e-81 PF22421: SYY_C-terminal" amino acids 340 to 414 (75 residues), 36.7 bits, see alignment E=4.8e-13

Best Hits

Swiss-Prot: 100% identical to SYY_AGRFC: Tyrosine--tRNA ligase (tyrS) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to atu:Atu1828)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UED2 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Atu1828 tyrosyl-tRNA synthetase (Agrobacterium fabrum C58)
MSRFKSDFLRTLDERGFIHQISDEAGLDELFAKETVTAYIGYDPTASSLHVGHLTQIMML
HWMQKTGHQPISLMGGGTGMVGDPSFKEEARKLMTIDMIEDNITSLKHVFANYLDYDRAE
NPALMINNADWLRGLNYLEFLRDVGRHFSVNRMLSFDSVKTRLDREQSLSFLEFNYMILQ
AYDFVELNQRTGCRLQMGGSDQWGNIINGIDLGHRMGTPQLYALTSPLLTTSSGAKMGKS
ASGAVWLNKDLLPVYDFWQYWRNTEDADVVRFAKLFTTLPMDEIARIATLGGSEINEAKK
ILATEVTAILHGRAAAEEAAETARKTFEEGALAENLPSIEVPTSELDAGVGVLSLIVRAG
LASSNGEARRHVQGGAVKINEQGVSDERQIIGTGEVTGDGVIKLSVGKKKHVLVRPA