Protein Info for Atu1822 in Agrobacterium fabrum C58

Annotation: transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR01981: FeS assembly protein SufD" amino acids 140 to 411 (272 residues), 294 bits, see alignment E=5.1e-92 PF01458: SUFBD_core" amino acids 169 to 394 (226 residues), 247.5 bits, see alignment E=1.3e-77

Best Hits

KEGG orthology group: K09015, Fe-S cluster assembly protein SufD (inferred from 100% identity to atu:Atu1822)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYG3 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Atu1822 transport system (Agrobacterium fabrum C58)
MNIQTTNRLTPAETALIDAYTAKFSELPGNGAVVAARDVLFDDLKTGGLPTRRIEAWHYT
DLKTLLRAIPDDQPAPVIDKQASLVAGSPVAYVLHGTANIGKIEDISVSSFAESLLDGTA
ATGLAEASKDDVIGRINGSFVRDGLTLDIPADAEIEKPIELQAIHGAGQVHSRFPVRFGK
GSKATVIERHLSVTSDAALVSSVSDIVVEDGAEVTWIILQQQGAADIHLGQLRMKIGADA
KVRLFVINAGGKLVRQELRIDVDGEGTDLIVRGVNLLGGETHTDVTMVLGHNVPNTTSAE
VFRNVVFDRAKGIFQGMIRVAPDAQKTDAKMACNTLLMSDDGEFSAKPELEIFADDVQCG
HGATVADIDDNHLYYLMARGVPRAKARAMLVNAFVAEIVEELEEENLVEALEAIISGWLE
HHA