Protein Info for Atu1795 in Agrobacterium fabrum C58

Annotation: malonate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 124 to 147 (24 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details PF03547: Mem_trans" amino acids 4 to 304 (301 residues), 96.9 bits, see alignment E=4.9e-32

Best Hits

Swiss-Prot: 69% identical to MDCF_RHIME: Putative malonate transporter (mdcF) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K07088, (no description) (inferred from 100% identity to atu:Atu1795)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIM1 at UniProt or InterPro

Protein Sequence (312 amino acids)

>Atu1795 malonate transporter (Agrobacterium fabrum C58)
MADIIGLLLPFFGLIFIGYGAARITKQPVEAMGWLNTFIIYAALPALFFKLVSKTPVEEL
ARMDFVAASLACTYGIFLAVFLIGRFVRRNSLAETTIQSFAASYGNIGYMGPGLALLALG
EKAAVPVALIVCLENAAHFIVAPAMMAVAGGDKRSAGKLALDVARKVITHPFIVSVIAGF
LAASLSWQPPEAVQRLVDYLAQSAAPCALFAMGVTLALRPMKRVPVEISYIVPAKLILHP
LAAYLVLSSLGRFEPVWIYSAVLLAALPTATNVFVIGQQYHVWQERASATILISTVLSVF
TLTGVVYFIQPF