Protein Info for Atu1791 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 15 to 38 (24 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 147 to 165 (19 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 275 to 291 (17 residues), see Phobius details amino acids 296 to 319 (24 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 62 to 338 (277 residues), 134.7 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to atu:Atu1791)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIM5 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Atu1791 ABC transporter, membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MRIELEKRAGVSRLFTLLSPLLALVLTLLVGAVMFAMLGKNPLDALYAFFVEPLLEVWSL
HELAIKAAPLILIGVGLSICYRSNNWNIGAEGQFTIGAITGSILPVLYPDWHSPLILPLM
MVMGAIGGALYAGIPALLKTKFNTNEILVSLMLVYVAQLFLDWLTRGIWRDPGGYNFPQT
KPFNDSAVLPEMLASGRAHWGFVFAIVAAIALWFMMRYMLKGFEVTVLGQSARAGRFAGF
SSSRMVWFSLLLSGALAGLAGISEASGSIGHLQPSISPGYGFTAIIVAFLGRLNPLGIIL
SGLVLALTYLGGEAAQLSIGVSDKVTRVFQGLMLFFVLSCDTLIFYRIRVVFAGKTHRKE
GAA