Protein Info for Atu1774 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (peptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00496: SBP_bac_5" amino acids 110 to 526 (417 residues), 217.3 bits, see alignment E=1.8e-68

Best Hits

Swiss-Prot: 54% identical to Y3576_BRUSU: Putative binding protein BRA0576/BS1330_II0571 (BRA0576) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 100% identity to atu:Atu1774)

Predicted SEED Role

"ABC transporter, periplasmic substrate-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIN5 at UniProt or InterPro

Protein Sequence (615 amino acids)

>Atu1774 ABC transporter, substrate binding protein (peptide) (Agrobacterium fabrum C58)
MRNLAALLPALFLLGSSLLPAGTALAQPLHGISMHGTPELPADFRHFPYVNPDVKKGGRI
SYGVVGTFDSLNPFVLKGMRTTARGVWDPEFGNLLYESLMLRSSDEPFSLYGLLAETVEW
DDERSFIQFNINPRAKWSDGKPVTPDDVIFTFSLLKEKGRPPFNSRLDGVAKMEKVGDRG
VRFTFNDKANRETPLILASSTPILPKHAIDPEKFEQAGLGPVVGSGPYRIKTLRPGERII
WERNPDYWGKDIPGKVGFDNYDEISVTYFLQVTTMFEAFKKGDIDIYPEGDAINGTSDTS
HWGQAYNFPAVHRGDIVKDVFQPRLPTGMFGLVFNTRRATFADEKVREGLSYALDFEWLN
RNILGGSFKRTQSYWQNSPLGAYGNAADERELALLGDAAKTMPAELLAGTYAMPTTDGTG
ADRKVLKLAVDKLKEAGYSIKNGKMSDANGRQLAFEIMTQNPAQERIALAYQRSLNLIGV
AMGIRSVDDGQYQARSNSFDYDMIIRSLPSSLSPGMEQLNRWNSLSRDAQGSFNYAGVAN
PDIDRMIEALLQARSTEDFQAAVRAYDRLLVAGHYIIPLYYIGAQWVARWKYIDRPDMTP
ISGNQKQTWWDARVQ