Protein Info for Atu1771 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 119 (18 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF00892: EamA" amino acids 16 to 147 (132 residues), 54.4 bits, see alignment E=8.5e-19 amino acids 162 to 298 (137 residues), 54.4 bits, see alignment E=8.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1771)

Predicted SEED Role

"FIG00364350: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CIN6 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Atu1771 hypothetical protein (Agrobacterium fabrum C58)
MSNKPASQQTRLTDWLIFLAVPFFFSSNVIFGRGVVGEVSPFIAAFIRWMGSTLIIAPFM
IADWRNCLAFVRDKMLLWLVLGILGMGICGGVVYWGLTMTTAANGTLIYTTSSLFIILFQ
RIFQGRPIRKLEVAGMVIAFAGVAAIVLKGDISALRHMNFNIGDFAILTAAIAFAIYSLL
LRDPAARQMASFSLFGLIAFSGALVLLPPAALELAQGGMLPATGAAWAKIGGIILFASLL
AFYCFTHTVRVFGPATAGITLYMMPPVSILMATIFLGETFETYHAIGIVLVTGGVILATA
PIGRKR