Protein Info for Atu1759 in Agrobacterium fabrum C58

Annotation: L-serine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03315: SDH_beta
  • amino acids 4 to 161 (158 residues), 187.5 bits, E=2e-59
• TIGR00720: L-serine ammonia-lyase
  • amino acids 4 to 464 (461 residues), 618.6 bits, E=3.5e-190
• PF03313: SDH_alpha
  • amino acids 199 to 461 (263 residues), 303.2 bits, E=1.9e-94

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 100% identity to atu:Atu1759)

Predicted SEED Role

"L-serine dehydratase, beta subunit (EC 4.3.1.17) / L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• D-serine degradation (3/3 steps found)
• L-serine degradation (3/3 steps found)
• glycine degradation (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• glycine betaine degradation I (6/8 steps found)
• L-cysteine degradation II (2/3 steps found)
• L-tryptophan degradation II (via pyruvate) (2/3 steps found)
• glycine betaine degradation III (4/7 steps found)
• felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
• L-mimosine degradation (4/8 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• purine nucleobases degradation II (anaerobic) (14/24 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycine, serine and threonine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

See A9CIP0 at UniProt or InterPro

Protein Sequence (467 amino acids)

>Atu1759 L-serine dehydratase (Agrobacterium fabrum C58)
MFLSVFDVFKIGIGPSSSHTMGPMTAANRFLALILSDEWPRPAGAAVAQLKVSLHGSLAF
TGIGHGTGRAVVLGLTGERPDLVDPDAMDAIIETVEKAGTVTPPGHPSYVFRPAEDLVFD
KKNPLPGHANGMIFSAFDNQGRLLIKRIYYSVGGGFVVTDTELEAIKQRGKTIDNGPRVP
YPFASAREMLDMATRSGRTIAQMKRANEETVVSRDELNERLDQIWEAMNGCIERGLKVDG
IMPGGLKVRRRARSIYEKLNEEWRSNRLNPVMANDWLSVYAMAVNEENAAGGRVVTAPTN
GAAGVVPATVRYFRHFHEDATVDDVRDFLLTAAAIGGIIKHNASISGAEVGCQGEVGSAA
AMAAAGLAAVMGGSPEQIENAAEIALEHHLGMTCDPIAGLVQVPCIERNALGAVKAVTAA
SLALKGDGQHFVPLDACIETMRQTGNDMSEKYKETSTGGLAVNVVEC