Protein Info for Atu1747 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 PF01809: YidD" amino acids 36 to 98 (63 residues), 82.5 bits, see alignment E=7.5e-28 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 38 to 104 (67 residues), 73.4 bits, see alignment E=5.4e-25

Best Hits

Swiss-Prot: 100% identical to YIDD_AGRFC: Putative membrane protein insertion efficiency factor (Atu1747) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K08998, hypothetical protein (inferred from 100% identity to atu:Atu1747)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEL0 at UniProt or InterPro

Protein Sequence (119 amino acids)

>Atu1747 hypothetical protein (Agrobacterium fabrum C58)
MCGEPGCRHEQTAVKAGRSRNWAGSFAKTPGRLFGVGFIRLYQLTLSGFVGNSCRHIPTC
SEYGYEAIARHGLWAGGWMALFRVARCGPGGTSGLDPVPEELDGSKRWWTPWRYWSRHR