Protein Info for Atu1729 in Agrobacterium fabrum C58

Annotation: putative molybdenum cofactor biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00994: MoCF_biosynth" amino acids 14 to 174 (161 residues), 116.3 bits, see alignment E=9.6e-38 PF24102: FLAD1_M" amino acids 179 to 247 (69 residues), 55.1 bits, see alignment E=5.5e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu1729)

Predicted SEED Role

"N-terminal domain of CinA protein, COG1058"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7CYN5 at UniProt or InterPro

Protein Sequence (263 amino acids)

>Atu1729 putative molybdenum cofactor biosynthesis protein (Agrobacterium fabrum C58)
MSNPSSTSSVVTAAMLAIGDELLSGRTKDKNIGHLADVLTMSGIDLKEVRIVADEEESIV
EALNALRSRYDYVFTSGGIGPTHDDITADAISAAFGLPCEHDAEALRLLGDMYRVREMEF
TEARKRMARMPKGAAHIANPVSVAPGFVIGNVYVMAGVPQVFQAMLDNVMPTLRTGAKVM
SQAVRSPYGEGDIGTPLTAIQKAHPETSIGSYPKYDGQRFSTEIVVRARDAGLLKAATEA
VAAMIEAIGQEKQLAASKGDATA