Protein Info for Atu1712 in Agrobacterium fabrum C58

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 TIGR01353: putative dGTPase" amino acids 37 to 398 (362 residues), 326.6 bits, see alignment E=1.6e-101 PF01966: HD" amino acids 75 to 217 (143 residues), 52.4 bits, see alignment E=6.3e-18 PF13286: HD_assoc" amino acids 306 to 396 (91 residues), 89.1 bits, see alignment E=2.2e-29

Best Hits

Swiss-Prot: 100% identical to DGTL1_AGRFC: Deoxyguanosinetriphosphate triphosphohydrolase-like protein (Atu1712) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01129, dGTPase [EC: 3.1.5.1] (inferred from 100% identity to atu:Atu1712)

Predicted SEED Role

"dNTP triphosphohydrolase, broad substrate specificity, subgroup 2"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UEP3 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Atu1712 deoxyguanosinetriphosphate triphosphohydrolase (Agrobacterium fabrum C58)
MIIDQRALGFGSGERAVFASDPWTTRGRLFPEAGSLTRSEFQRDRDRIVHTTAFRRLKHK
TQVFISPDGDHYRTRLTHTIEVAQIARALARALKLDEDLAEGVALVHDFGHTPFGHTGED
ALDAVLLPYGGFDHNAQSLRIVTKLERRYAEYDGINLTWETLEGLVKHNGPLVNAKGEGI
KGPVPLPILEYCVLQDLEIGSYASLEAQVAAIADDIAYNTHDIDDGLRAGYLTFEMLEEV
PFLSKLMAEVRGKYPVLDKERFANEIMRRQITHMVEDVIGVAQQNLARLKPQSAADIRAA
DFTVATFSPEMAETDRQIKKLLFGHIYRHPEIMRIRAGATQIVTDLFHRYMETPAEMQSH
YWVDSISGMSVAAKARHVGDYLAGMTDSYALRAHQRLFDHTPDLR