Protein Info for Atu1695 in Agrobacterium fabrum C58

Annotation: molybdenum cofactor biosynthesis protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 21 to 349 (329 residues), 371.3 bits, see alignment E=2e-115 PF04055: Radical_SAM" amino acids 34 to 197 (164 residues), 112.8 bits, see alignment E=2.9e-36 PF13353: Fer4_12" amino acids 38 to 142 (105 residues), 35.9 bits, see alignment E=1.3e-12 PF06463: Mob_synth_C" amino acids 202 to 328 (127 residues), 138.1 bits, see alignment E=2.5e-44

Best Hits

Swiss-Prot: 100% identical to MOAA_AGRFC: GTP 3',8-cyclase (moaA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to atu:Atu1695)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8UER0 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Atu1695 molybdenum cofactor biosynthesis protein A (Agrobacterium fabrum C58)
MNSFSGSLEKAKTLTENNAPMVDPFGRAITYLRVSVTDRCDFRCTYCMSEHMTFLPKKDL
LTLEELDRLCSVFITRGVRKLRLTGGEPLVRKNIMSLVRNLGRHVQSGTLDELTLTTNGS
QLAKFAAELADCGVRRINVSLDTLDAQKFRQITRWGDIDRVMEGFDAAQAAGIKVKLNAV
ALKDFNDAEMPELMRFAHGRGMDLTVIETMPMGEIEEDRTDRYLPLSQLRADLERNFTLV
DSDYQTGGPARYVTVKETGGRLGFITPMTHNFCESCNRVRLTCTGTLYMCLGQDDAADLR
TALRASDSDAYLSAAIDEALLRKPKGHDFIIDRTHNRPAVSRHMSVTGG