Protein Info for Atu1687 in Agrobacterium fabrum C58

Annotation: anthranilate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 5 to 66 (62 residues), 83.7 bits, E=6.1e-28
• TIGR01245: anthranilate phosphoribosyltransferase
  • amino acids 9 to 332 (324 residues), 384.7 bits, E=1.9e-119
• PF00591: Glycos_transf_3
  • amino acids 75 to 323 (249 residues), 308.4 bits, E=4.6e-96

Best Hits

Swiss-Prot: 100% identical to TRPD_AGRFC: Anthranilate phosphoribosyltransferase (trpD) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00766, anthranilate phosphoribosyltransferase [EC: 2.4.2.18] (inferred from 100% identity to atu:Atu1687)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase (EC 2.4.2.18)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

See Q8UER8 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Atu1687 anthranilate phosphoribosyltransferase (Agrobacterium fabrum C58)
MAELKPLIAKVANGESLNREDARTAFDILMSGEATPSQIGGFLMALRVRGETVDEIVGAV
SSMRARMLPVSAPANAIDIVGTGGDGIGTYNISTLASIITAGTGLPVAKHGNRALSSKSG
TADALSALGVRLDIGPDLIARCIAEAGLGFMFAQMHHSAMRHVGPSRVELGTRTIFNLLG
PLSNPAGAKRQLLGVFSPRWLVPLAEVLRDLGSESIWVVHGDGMDEVTTTGVTHVAALED
GKIRTFDLTPKDFGVEPALMNDLKGGDGIANAAALREVLSGKRNAYRDISLCNAAAALVI
AGKAETLSQAMTIASDALDSGKAAAALDRLVAVSNEANSGQE